SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015956 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015956
Domain Number 1 Region: 31-429
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.83e-126
Family AAT-like 0.00000000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015956   Gene: ENSRNOG00000011782   Transcript: ENSRNOT00000015956
Sequence length 430
Comment pep:known chromosome:RGSC3.4:19:9629691:9655336:1 gene:ENSRNOG00000011782 transcript:ENSRNOT00000015956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLHSGRVLSGMAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAGKNLDKEYLPIGGLADFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEMAAVVKKKNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
AKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGY
LAHAIHQVTK
Download sequence
Identical sequences P00507
NP_037309.1.100692 NP_037309.1.4139 ENSRNOP00000015956 ENSRNOP00000015956 10116.ENSRNOP00000015956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]