SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015974 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015974
Domain Number 1 Region: 2-423
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.15e-81
Family AAT-like 0.00000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015974   Gene: ENSRNOG00000011861   Transcript: ENSRNOT00000015974
Sequence length 425
Comment pep:known chromosome:RGSC3.4:16:32845008:32885600:-1 gene:ENSRNOG00000011861 transcript:ENSRNOT00000015974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSRFLTATSLARKTSPIRATVEIMSRAPKDIISLAPGSPNPKVFPFKSAVFTVENGST
IRFEGEMFQRALQYSSSYGIPELLSWLKQLQIKLHNPPTVNYSPNEGQMDLCITSGCQDG
LCKVFEMLINPGDTVLVNEPLYSGALFAMKPLGCNFISVPSDDCGIIPEGLKKVLSQWKP
EDSKDPTKRTPKFLYTIPNGNNPTGNSLTGDRKKEIYELARKYDFLIIEDDPYYFLQFTK
PWEPTFLSMDVDGRVIRADSLSKVISSGLRVGFITGPKSLIQRIVLHTQISSLHPCTLSQ
LMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKV
NGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQL
IKDVS
Download sequence
Identical sequences Q64602
NP_058889.1.100692 NP_058889.1.4139 ENSRNOP00000015974 ENSRNOP00000015974 10116.ENSRNOP00000015974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]