SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016073 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016073
Domain Number 1 Region: 28-296
Classification Level Classification E-value
Superfamily L domain-like 6.63e-55
Family Internalin LRR domain 0.04
Further Details:      
 
Domain Number 2 Region: 253-407
Classification Level Classification E-value
Superfamily RNI-like 5.34e-31
Family 28-residue LRR 0.05
Further Details:      
 
Domain Number 3 Region: 1448-1537
Classification Level Classification E-value
Superfamily PDZ domain-like 9.05e-23
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016073   Gene: ENSRNOG00000011980   Transcript: ENSRNOT00000016073
Sequence length 1541
Comment pep:known chromosome:RGSC3.4:2:256228792:256644031:-1 gene:ENSRNOG00000011980 transcript:ENSRNOT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCLEMTTKRKLIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDAN
QIEELPKQLFNCQALRKLSIPDNDLSSLPTSIASLVNLKELDISKNGVQEFPENIKCCKC
LTIIEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTL
PKSMHKLAQLERLDLGNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLD
MSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIG
NLSLLEEFDCSCNELESLPPTIGYLHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNK
LEFLPEEIGQMQRLRVLNLSDNRLKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPE
TKQRVLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDESAGKV
KALSCQAPWDRGQRGITLQPARLSGDCCTPWARCDQQIQDMPVPQSDPQLAWGCISGLQQ
ERSMCAPLPVAAQSTTLPSLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRV
ENANPTANTEQTVKEKFEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPPKL
VLLGKDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSASSNTRVKVGSLQPTTKDA
VHNSLWGNRCANIYPEPRDAKPLLTQREAVPPGNLPQRPDRLPMSDAFPDNWTDGSHYDN
TGFVSEEATGENANNNPLLSSKARSVPAHGRRPLIRQERIVGVPLELEQSTHRHTPETEV
PPSNPWQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKDHMKEPTETPGPFSPGVPWEY
HDPTPNRSLGNVFSQIHCRPDSSKGVIAISKSTERLSPLMKDIKSNKFKKSQSIDEIDVG
TYKVYNIPLENYASGSDHLGSHERPDKFLGPEHGMSSMSRSQSVPMLDDEMLMYGSSKGP
PQQKASMTKKVYQFDQSFNPQGAVEVKAEKRIPPPFAHNSEYVQQPGKNIAKDLVSPRAY
RGYPPMEQMFSFSQPSVNEDAMVNAQFASQGPRAGFLRRADSLASSTEMAMFRRVSEPHE
LPPGDRYGRAAYRGGLEGQSSVSMTDPQFLKRNGRYEDEHPSYQEVKAQAGSFPAKNLTQ
RRPLSARSYSTESYGASQTRPVSARPTMAALLEKIPSDYNLGNYGDKTSDNSDIKTRPTP
VKGEESCGKMPADWRQQLLRHIEARRLDRNAAYKHNTVNLGMLPYGGISAMHAGRSMTLN
LQTKSKFDLQDLPLQKTPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSH
IQTLMGSQSLQHRSREQQPYEGNINKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKG
QRSMDGYPEQFCVRIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQP
GDKILQANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTV
Download sequence
Identical sequences ENSRNOP00000016073 10116.ENSRNOP00000016453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]