SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016088 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016088
Domain Number 1 Region: 34-96
Classification Level Classification E-value
Superfamily Midkine 6.28e-24
Family Midkine, a heparin-binding growth factor, N-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 99-141
Classification Level Classification E-value
Superfamily Midkine 1.74e-19
Family Midkine, a heparin-binding growth factor, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016088   Gene: ENSRNOG00000011946   Transcript: ENSRNOT00000016088
Sequence length 168
Comment pep:known chromosome:RGSC3.4:4:64078757:64160135:-1 gene:ENSRNOG00000011946 transcript:ENSRNOT00000016088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSG
DCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTG
SLKRALHNADCQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Download sequence
Identical sequences P63089 P63090
ENSMUSP00000099073 ENSMUSP00000099073 ENSMUSP00000099073 NP_032999.1.92730 NP_058762.1.100692 NP_058762.1.4139 XP_006505820.2.92730 XP_021046102.1.100879 XP_021046103.1.100879 10090.ENSMUSP00000099073 10116.ENSRNOP00000016088 ENSRNOP00000016088 ENSRNOP00000016088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]