SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016145 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016145
Domain Number 1 Region: 1-20,97-206
Classification Level Classification E-value
Superfamily SNARE-like 8.06e-35
Family Sedlin (SEDL) 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000016145
Domain Number - Region: 53-99
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00132
Family PDZ domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016145   Gene: ENSRNOG00000011904   Transcript: ENSRNOT00000016145
Sequence length 219
Comment pep:known chromosome:RGSC3.4:8:47370712:47373920:-1 gene:ENSRNOG00000011904 transcript:ENSRNOT00000016145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIFSVYVVNKAGGLIYQWDSYSPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVG
HAVLAINGMDVNGKYTADGKEVLEYLGNSANYPVSIRFGRPRLTSNEKLMLASMFHSLFA
IGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDF
ALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS
Download sequence
Identical sequences A0A0G2JSL2 G3I977
XP_003511612.1.69978 XP_005347245.1.66349 XP_007618908.1.28591 10116.ENSRNOP00000016145 ENSRNOP00000016145 ENSRNOP00000016145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]