SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016148 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016148
Domain Number 1 Region: 18-97
Classification Level Classification E-value
Superfamily HR1 repeat 3.92e-19
Family HR1 repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 502-591
Classification Level Classification E-value
Superfamily PDZ domain-like 3.46e-17
Family PDZ domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016148   Gene: ENSRNOG00000011885   Transcript: ENSRNOT00000016148
Sequence length 686
Comment pep:known chromosome:RGSC3.4:1:87853620:87917634:1 gene:ENSRNOG00000011885 transcript:ENSRNOT00000016148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDALLPAAPQPLEKESDDYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENL
LKVTTNQKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQGTEEAFTIPLIPLGLKET
KEVDFSIVFKDFILEHYSEDSYLYEDDIADLMDLRQACRTPSRDEAGVELLMSYFIQLGF
VESRFFPPTRHMGLLFTWYDSFTGVPVSQQTLLLEKASILFNIGALYTQIGTRCNRQTEA
GLESAVDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKICLLGI
QNEFFVLVKVAQEAAKVAAAYRQLHAAMSQEPVKENIPYSWASVAYVKAYHYGALAHYFA
ATLLIDHQLKPGADEDHQEKCLSQLYDRMPEGMTPLATLKNDGQRVLLGKGHLHRAIDYH
KESLREANLCKKLRDIQVLRDVLSAAHQRTQLKYTQHQQDDDLLNLIDAPDVLPKTEREV
KITFPDFSKVTVTDFFQKLGPLSVFSASKRWSPPRGIHFRVEEGDLGFTLRGNTPVQVHF
LDPHCSASLAGAKEGDYIVSIQGLDCKWLTVSEVMKLLKSFGGEEVEMKVVSLLDSTSSM
HNKCATYSVGMQKTYSMICLSMDDDDKADKTKKISKKPSFLSWSTSKNRQKSASTLCLPN
VGLARPQNKKKLPTPFSLLNSDSSLY
Download sequence
Identical sequences D4A8N7
NP_001100975.1.100692 NP_001100975.1.4139 XP_006228949.1.100692 ENSRNOP00000016148 10116.ENSRNOP00000016148 ENSRNOP00000016148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]