SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016289 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016289
Domain Number 1 Region: 207-307
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-27
Family PDZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 1102-1193
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family Interleukin 16 0.0000516
Further Details:      
 
Domain Number 3 Region: 330-440
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-20
Family PDZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 1214-1311
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family Interleukin 16 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016289   Gene: ENSRNOG00000011680   Transcript: ENSRNOT00000016289
Sequence length 1323
Comment pep:known chromosome:RGSC3.4:1:139908061:140000146:-1 gene:ENSRNOG00000011680 transcript:ENSRNOT00000016289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPHSHSGKSRKSTKFRSISRSLILCNAKTSDDSSSPDEKYPDPFETSLCQDKEGFFHSS
MQLADTSEAGLSNIPDLALASEAAQLQAAGSDRGKHCRKMFFLKESSTTSSKEKAGKSEA
QSSNFLFPKACHQRTRSNSTSVNPYSAREMDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
DYPVSGTARPTRSLSTAQLGQLSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIG
IYVKSIFAGGAAAADGRLQEGDEILELNGESIAGLTHQDALQKFKQAKKGLLTLTVRTRL
TTPPSLCSHLSPPLCRSLSSSTCGAQDSSPFSLESPASPASTAKPNYRIMVEVSLKKEAG
VGLGIGLCSIPYFQCISGVFIHTLSPGSVAHLDGRLRCGDEIVEINDSPVHCMTLNEVYT
ILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVEGVKFGKERHQWSLEGVKRLESSWH
GRPTLEKEREKHSAPPHRRAQKIMVRSSSDSSYMSGSPGGSPCSAGAELQPSEGEGSTHS
PSLPPGEEQEPCPGVPSRPHQESPPLSESLERDSHPPLKLKNSFEILVRKPTSTKPKPPP
RKYFKNDSEPQKKLEEKEKVTDPSGHTLPTCSQETRELLPLLLQEDTAGRTLCTAACCPG
PAASTQTSSSTEGEPRRSASPETPASPGKHPLLKRQARMDYSFDSTTEDPWVRISDCIKN
LFSPIMSENHSHMPLQPNASLGEEDGTQGHPEGGLSKMDTANGAPRIFKSADGSTVKKGP
PVAPKPAWFRQSLKGLRNRVPETRRAPEVASAIQTTPVSRDASGPQSQASSSSIRQRISS
FENFGSSQLPDRGVQRLSLQPTSGETTRLPGKQDEGRFSGLPAQGTKVTAKHRQTEVEPP
STTFPNSSEVGDPDMSESPPPGQRPNPKALSPDPLLRLLTTQTEDTQGPGFKMPSQRARS
FPLTRTQSYETKLLDEKSSKLYSISSQLSSAVMKSLLCLPSSASCGQITCIPKERVSPKS
PCNNSAAAEGFGEAVASDTGFSLNLSELREYSEGLTEPGETEDRNHCSSQAGQSVISLLS
AEELKKLIEEVRVLDEATLKQLDSIHVTVLHKEEGAGLGFSLAGGADLENKVITVHRVFP
NGLASQEGTIQKGNEVLSINGKSLKGATHNDALAILRQARDPRQAVIVTRKAIVEAAHDL
NSSTDSAASASVASGISVESVEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIF
KGTEQGDAVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTVVIRRNGLEGKQTTAS
ADL
Download sequence
Identical sequences D4A4I9
10116.ENSRNOP00000016289 ENSRNOP00000016289 ENSRNOP00000016289 NP_001099219.1.100692 NP_001099219.1.4139 XP_008757822.1.100692 XP_017444166.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]