SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016416 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016416
Domain Number 1 Region: 322-465
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.22e-18
Family Deoxycytidylate deaminase-like 0.01
Further Details:      
 
Domain Number 2 Region: 76-162
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000000000116
Family Deoxycytidylate deaminase-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016416   Gene: ENSRNOG00000012209   Transcript: ENSRNOT00000016416
Sequence length 523
Comment pep:known chromosome:RGSC3.4:15:38658776:38687199:-1 gene:ENSRNOG00000012209 transcript:ENSRNOT00000016416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKETDPMQSLEGSGAERSVGTQTGSMTGQIPRLSKVNLFTLLSLWMELFPGVEAQGQKSQ
KTEEETRGPLGDNEDLARVSTDKKQVKKTGLVVVKNMKIIGLHCSSEDLHTGQIALIKHG
SRLKNCDLYFSRKPCSACLKMIVNAGVNRISYWPSDPEISLLTEASSSEDAKLDAKAAER
LKSNSRAHVCVLLQPLVCYMVQFVEETSYKCDFIQKTAKALPGADTDFYSECKQERIKEY
EMLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLILLLATVASSVPNLKHFGFY
CSNPEQINEIHNQSLPQEVARHCMVQARLLAYRTEDHKTGVGAVIWAEAKSRSCDGTGAM
YFVGCGYNAFPVGSEYADFPHMDDKHKDREIRKFRYIIHAEQNALTFRCQDIKPEERSMI
FVTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMKFGELEGVHKFTWQLNPSEAY
SLDPDEPERRENGVLRRRSAKEEQRSNKRPRLETRSAGRATLQ
Download sequence
Identical sequences ENSRNOP00000016416 XP_006252185.1.100692 10116.ENSRNOP00000016416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]