SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016642 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016642
Domain Number 1 Region: 148-391
Classification Level Classification E-value
Superfamily vWA-like 3.02e-81
Family Integrin A (or I) domain 0.000000371
Further Details:      
 
Domain Number 2 Region: 391-481
Classification Level Classification E-value
Superfamily Integrin domains 4.13e-27
Family Integrin domains 0.0028
Further Details:      
 
Domain Number 3 Region: 42-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000942
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 645-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000693
Family Integrin beta tail domain 0.0084
Further Details:      
 
Domain Number 5 Region: 604-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Integrin beta EGF-like domains 0.0099
Further Details:      
 
Domain Number 6 Region: 561-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Integrin beta EGF-like domains 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000016642
Domain Number - Region: 535-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.022
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016642   Gene: ENSRNOG00000012208   Transcript: ENSRNOT00000016642
Sequence length 807
Comment pep:known chromosome:RGSC3.4:7:140971341:140984091:-1 gene:ENSRNOG00000012208 transcript:ENSRNOT00000016642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSSTVLIFLLVLGGGQSELDTKITSSGETTEWEDPDLSPQGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPEQELEEPRGHQEVLQDRPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGQALLL
RLREVTHSVRIGFGSFVDKTVLPFVSTVPSKLNHPCPSRLERCQAPFSYHHVLPLTRDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELS
QLIPKSAVGELSEDSSNVVQLIMDAYDNLSSTVTLEHSSLPPGVSISFESHCRSPEKSEG
EAGDRRGQCNHVRVNQMVDFWVTLQASHCLPEAHVLRLWALGFSEELTVELHTLCDCNCS
DAQPRAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSG
KGRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANRTGRACECS
ESVDSCVSPEGGLCSGHGDCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGT
GPLAANCSAACADVNVTLALAPNLDDGWCKERTLDNQLFFFLVENSARGVILRVRPQEKG
ADHTRAIILGCVGGIVAVGLGLVLAYRLSVEVYDRLEYSRFEKERQQLNWKQDSNPLYKS
AVTTTVNPRFQGGNKQSLSLPLTQEAD
Download sequence
Identical sequences G3V7M2
ENSRNOP00000016642 10116.ENSRNOP00000016642 ENSRNOP00000016642 NP_037303.1.100692 NP_037303.1.4139 XP_006242445.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]