SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016742 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016742
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily UBC-like 1.27e-93
Family UBC-related 0.00000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016742   Gene: ENSRNOG00000005064   Transcript: ENSRNOT00000016742
Sequence length 152
Comment pep:known chromosome:RGSC3.4:10:37509326:37523900:-1 gene:ENSRNOG00000005064 transcript:ENSRNOT00000016742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Download sequence
Identical sequences A0A096MMR7 A0A0D9RMB6 A0A0P6J499 A0A0Q3QVB2 A0A151M704 A0A1D5NU23 A0A1S2ZIP6 A0A1S3GEI4 A0A1U7RC35 A0A1U7UDV5 A0A1U8BIY4 A0A218V3W6 A0A250YAA7 A0A286XH13 A0A2K5EAI1 A0A2K5JLZ6 A0A2K5QN00 A0A2K5XAH8 A0A2K6CFL8 A0A2K6G5P3 A0A2K6M734 A0A2K6R568 A0A2K6T6G6 A2RSE4 B5FZH8 E2RRR7 F6TQE0 F6XR18 F7HM77 G1MHK7 G1PLK6 G1R9J2 G3TPG1 H0XF18 H2PGK2 H2R5C5 H8Y100 H9YWP0 I3MAG4 I7GLU2 K9IGH7 L5JUV9 L5MHR3 L8IYN1 M3YFC9 P63146 P63147 P63148 P63149 Q32P99 W5PWV6
ENSOCUP00000013548 ENSMUSP00000020657 ENSMUSP00000104714 ENSPANP00000000902 ENSTSYP00000010226 ENSLAFP00000017271 ENSSARP00000012549 ENSCPOP00000006745 ENSSTOP00000006988 ENSAMEP00000018842 ENSSARP00000012549 ENSCAFP00000001440 ENSMLUP00000011746 ENSCJAP00000008769 ENSMMUP00000021885 ENSSTOP00000006988 ENSCJAP00000008769 ENSRNOP00000016742 ENSOGAP00000014583 NP_001032536.1.59421 NP_001032536.1.76553 NP_001075765.1.1745 NP_001181362.1.72884 NP_001232656.1.42559 NP_001244285.1.46622 NP_001272748.1.63531 NP_003328.1.87134 NP_003328.1.92137 NP_033484.3.92730 NP_112400.1.100692 NP_112400.1.4139 XP_001365713.1.35504 XP_001504446.1.31192 XP_002744203.1.60252 XP_002815935.1.23681 XP_002912961.1.58354 XP_003266432.1.23891 XP_003404544.1.64505 XP_003498537.2.69978 XP_003756508.1.9362 XP_003782233.1.62490 XP_003829322.1.60992 XP_004008850.1.66739 XP_004263677.1.21590 XP_004282167.1.21590 XP_004326551.1.83887 XP_004384772.1.4749 XP_004405508.1.74151 XP_004420249.1.5094 XP_004475961.1.11602 XP_004586466.1.84141 XP_004609924.1.94378 XP_004686786.1.23501 XP_004696674.1.18182 XP_004745019.1.14098 XP_004745021.1.14098 XP_004836632.1.39548 XP_005001321.1.53824 XP_005067842.1.91757 XP_005335799.1.77405 XP_005350168.1.66349 XP_005376195.1.28644 XP_005376196.1.28644 XP_005376197.1.28644 XP_005483648.2.73095 XP_005523560.1.90289 XP_005682999.3.57651 XP_005865629.1.60319 XP_005890473.1.15283 XP_005971960.1.78601 XP_005971961.1.78601 XP_006017270.1.24877 XP_006042865.1.26621 XP_006086655.1.53796 XP_006166917.1.99106 XP_006179679.1.101512 XP_006212866.1.17985 XP_006533223.1.92730 XP_006731085.1.47382 XP_006753613.1.95426 XP_006866140.1.41390 XP_006888125.1.29581 XP_006923187.1.64745 XP_006991396.1.50099 XP_007087803.1.5354 XP_007107133.1.24612 XP_007172212.1.59432 XP_007461422.1.90284 XP_007519968.1.11023 XP_007611221.1.28591 XP_007941952.1.48129 XP_008012630.1.81039 XP_008064056.1.4292 XP_008140471.1.99482 XP_008508310.1.77740 XP_008571799.1.73410 XP_008689824.1.72690 XP_008826147.1.79516 XP_010337001.1.74449 XP_010358245.1.97406 XP_010388975.1.2935 XP_010842816.1.44457 XP_010969923.1.22495 XP_010979846.1.51371 XP_011247269.1.92730 XP_011280410.1.62641 XP_011360616.1.92234 XP_011714883.1.29376 XP_011804049.1.43180 XP_011824604.1.47321 XP_011971417.1.54773 XP_011971418.1.54773 XP_012033885.1.66739 XP_012295859.1.9421 XP_012506779.1.63892 XP_012617628.1.48125 XP_012886412.1.60039 XP_012967187.1.91757 XP_013363975.1.28644 XP_014439062.1.99106 XP_014439063.1.99106 XP_014453153.1.47583 XP_014701900.1.49734 XP_014701901.1.49734 XP_014738930.1.99236 XP_014943106.1.86478 XP_015149580.1.86415 XP_015284960.1.55130 XP_015348252.1.40921 XP_015497391.1.82291 XP_015993145.1.101085 XP_016053036.1.3490 XP_017387875.1.71028 XP_017497437.1.32401 XP_017690111.1.3805 XP_017727468.1.44346 XP_019277527.1.44245 XP_019361828.1.87953 XP_019390630.1.79039 XP_019497767.1.44202 XP_019595855.1.88060 XP_020023973.1.5219 XP_020650093.1.8467 XP_020763715.1.74333 XP_020763716.1.74333 XP_020763717.1.74333 XP_020846866.1.61212 XP_021068731.1.100879 XP_021266154.1.32913 XP_021405119.1.53032 XP_021494547.1.76796 XP_021494548.1.76796 XP_021557902.1.83697 XP_517935.2.37143 XP_850657.1.84170 ENSPPYP00000017652 ENSBTAP00000040823 ENSMMUP00000021885 ENSOARP00000014939 ENSBTAP00000040823 ENSPPYP00000017652 1jas_A 2y4w_A 2yb6_A 2ybf_A ENSPTRP00000048028 ENSCPOP00000006745 ENSDNOP00000012192 ENSMPUP00000010036 ENSECAP00000014116 ENSOPRP00000006105 ENSMUSP00000020657 ENSTTRP00000015985 ENSTTRP00000015985 ENSMUSP00000020657 ENSECAP00000014116 ENSAMEP00000018842 ENSPTRP00000048028 ENSCAFP00000001440 ENSMODP00000017763 ENSFCAP00000003608 1jasA ENSOCUP00000013548 ENSMPUP00000010036 ENSOPRP00000006105 ENSNLEP00000009884 ENSNLEP00000009884 ENSP00000265339 ENSP00000265339 gi|4507771|ref|NP_003328.1| 000006524|e1jasA1|216.1.1.7|A:1-152 000180872|e2y4wA1|216.1.1.7|A:1-152 cath|current|1jasA00/1-152 cath|current|2y4wA00/1-152 cath|current|2yb6A00/2-151 cath|current|2ybfA00/3-152 d1jasa_ d2y4wa_ ENSMLUP00000011746 10090.ENSMUSP00000020657 10116.ENSRNOP00000016742 10141.ENSCPOP00000006745 13616.ENSMODP00000017763 9544.ENSMMUP00000021885 9598.ENSPTRP00000048028 9600.ENSPPYP00000017652 9606.ENSP00000265339 9615.ENSCAFP00000001440 9796.ENSECAP00000014116 9913.ENSBTAP00000040823 9986.ENSOCUP00000013548 ENSTSYP00000010226 ENSLAFP00000017271 ENSMODP00000017763 ENSP00000265339 ENSOGAP00000014583 ENSRNOP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]