SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016839 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016839
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 1.09e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-22
Family Third domain of FERM 0.0086
Further Details:      
 
Domain Number 3 Region: 46-138
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000283
Family PDZ domain 0.022
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000172
Family Ras-binding domain, RBD 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016839   Gene: ENSRNOG00000012546   Transcript: ENSRNOT00000016839
Sequence length 1538
Comment pep:known chromosome:RGSC3.4:5:61748052:61849725:1 gene:ENSRNOG00000012546 transcript:ENSRNOT00000016839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELEGGLSQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPPGNPAQALTAVQHTVTL
DKDVLLQNYGFHISETLPLTVVAVTAGGSAHGKLFPGDQILQMNKELAEDLSCERAVDIL
RETEDALSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKVYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELIQQVVEREESQDSRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCNSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIMSTLAEFANISRVELTEESEKVSVVKIYLQDVKVLTLLLESSSAKD
LTCLIAGYYRLFVDPANPVFLWSGNRQQTHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRCLVKLSLCRPFVREEQRPGDSPTPEVTRRGPSTCGASSMTDSAESEASDSANTESRGC
RTSGSSESMDALEEDDLDACSSSGTSFFHFGPPGFSKDLDTNSQEENSRVETSGFLCLLD
LAQNATSRCQKIEGPQSLASEACSWGPELSMGRLDPRLYEGSRTDYYSLCSSVSPGSHLS
DSGSESTTSRQGAAPPPWCPQDWMETQSGSMLETLALPALPTLALEDGSSDEEYYDAADK
LTPPDTLSGPRAADLSAMRLQSHSRTRGSEESLHPDPEGGEPSRQGGVKKYAKSPRKRRS
FLQTDHTSQVSFPMEPSASQENMDDVCYYDREPYLSLTAPSPTVSSLQDMKSEPGLLETK
ALGLLASLRETKSKNPASRIMEMEPETMETKSVIDSRVSSISAIRLRIDPGNTENPVTTD
GSSASIPHNPHPSNPGSSSPQAAQVRPLQSISPGQDAGGTTPKGLTAEPQDSTFPLSSAD
PNPDTPGPHHAPQGDTSELEEVRSEMGSGSVLINHIQEVTPQIAGPLCPSDGPTTSGEHG
VTSEEMALDAAEVRQENAPSLFHKGFGKDSGHFKGDGLDNIPQALDDANATTGEIGSSLC
SEPPATGLGRISPNSEGENQVAQEQELLAELDLGPNFLLGSAVLPELVEAEQLDHVIGED
SVPVDTSQQVCVHTVPPLPKLSPCQEEPRSADSGHGSPAESKGDSPITCLPPERSFLCFA
PESQPESSNSLSRVTSFSFAGMNEVVPAGIGIEHCRCQFPYATCFRGLQPETEEEDGDPQ
SHPAAPLTSPPSAGSQVTLPWRAARAYSCTTPLPRKSHIWPEYCSRALRQLKTAPANAPE
GFVQLTESLLELQDILEASWGVGNKHPPDKCTWHFSESRSRLCMGSQKLLSSCQHVIRMD
QSPEEMQGAVRVTFQHLVQLAGLCFQFTDCSRCSTRHREVAGNLRDVVYTYHQFVEAAKL
TCERGYHDLSVKLLARQCTALTAAVFCLTQKFRASTAL
Download sequence
Identical sequences ENSRNOP00000016839 10116.ENSRNOP00000016839 ENSRNOP00000016839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]