SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017054 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017054
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-23
Family PDZ domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 319-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000279
Family LIM domain 0.00086
Further Details:      
 
Domain Number 3 Region: 287-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000166
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017054   Gene: ENSRNOG00000012658   Transcript: ENSRNOT00000017054
Sequence length 364
Comment pep:known chromosome:RGSC3.4:16:49637068:49668810:-1 gene:ENSRNOG00000012658 transcript:ENSRNOT00000017054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAEAANLCPGDVILAIDGFGTESM
THADAQDRIKAASYQLCLKIDRAETRLWSPQVSEDGKAHPFKINLEAEPQDVNYFEHKHN
IRPKPFIIPGRTSGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKMAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPTASVPPQSDVYRMLHDN
RDEPAAPRQSGSFRVLQELVNDGSDDRPAGTRSVRAPVTKVHGGAGGAQRMPLCDKCGSG
IVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCEMHARARTRPPEGYDTVTL
YPKA
Download sequence
Identical sequences D3ZFR7
ENSRNOP00000017054 ENSRNOP00000017054 10116.ENSRNOP00000017054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]