SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017223 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017223
Domain Number 1 Region: 234-296
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0058
Further Details:      
 
Domain Number 2 Region: 361-421
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 3 Region: 312-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000017223
Domain Number - Region: 178-236
Classification Level Classification E-value
Superfamily PKD domain 0.0353
Family PKD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017223   Gene: ENSRNOG00000012811   Transcript: ENSRNOT00000017223
Sequence length 507
Comment pep:known chromosome:RGSC3.4:3:105757666:105770344:1 gene:ENSRNOG00000012811 transcript:ENSRNOT00000017223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRLAQASISTVCVWLLCALGLQGTETELPSAPPEFSGGAACLNRFTSGVPAFVLDTE
ASVSNGATFLGSPTVHRGWDCVRACCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQN
FVCKFAPKDGFINYLTQDLYNSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLRDADN
TDWHLLQGDQDVSVKRNHPEEVELWGLKEGTYLFQLTRTDSDQLEETVNLTITVLTAEQT
EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKDVKGI
SPKRHHPVCTGSCHSTQFQCSNGCCIDGFLECDDTPDCPDGSDEATCEKYSSGFDELQSI
HFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEKEQQCLESCR
GISKKDVFGLRRESSVPSAGSVEVAIAVLLAVCIIVVLTILGYCFFKNQKKNFHSPLHQP
PPTPASSTVSTTEDTEHLVYNHTTQPL
Download sequence
Identical sequences Q4V8Q2
10116.ENSRNOP00000017223 NP_001004265.2.100692 NP_001004265.2.4139 XP_006234825.1.100692 XP_006234826.1.100692 ENSRNOP00000017223 ENSRNOP00000017223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]