SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017324 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017324
Domain Number 1 Region: 73-166
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000000945
Family Transcription factor IIB (TFIIB), core domain 0.024
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000623
Family Transcriptional factor domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000017324
Domain Number - Region: 201-237
Classification Level Classification E-value
Superfamily Cyclin-like 0.00178
Family Transcription factor IIB (TFIIB), core domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017324   Gene: ENSRNOG00000012739   Transcript: ENSRNOT00000017324
Sequence length 416
Comment pep:known chromosome:RGSC3.4:16:69250416:69255134:1 gene:ENSRNOG00000012739 transcript:ENSRNOT00000017324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
ENEQVSRSQQRDLRRVRDLCRILKLPLTFEETAVSYYQKAYQLSGIRAARLQKKEVVVGC
CVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLADLVKSYCSSF
KLFQASPSMPAKYVEDKDKMLSRTLLLVELANETWLVTGRHPLPIITAATFLAWQSLRPS
DRLTCSLARFCKLANVDLPYPAASRLQELLAVLLQMASQLAWLQVLRLDKRSVVKHIGDL
LQHRHMLVRMAFQDGTAEVETKQQQPQGRGQQEEVGDSTFDLPKRKRPASPALLLPPCML
KPPKRTHTMPPDSVVTGDEDISDSEIEQYLRTPQEVRDFERAQAASRAAMSVPNPP
Download sequence
Identical sequences Q4V8D6
ENSRNOP00000017324 NP_001019944.1.100692 NP_001019944.1.4139 10116.ENSRNOP00000017324 ENSRNOP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]