SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017785 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017785
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily MAPEG domain-like 1.44e-43
Family MAPEG domain 0.000059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017785   Gene: ENSRNOG00000013296   Transcript: ENSRNOT00000017785
Sequence length 147
Comment pep:known chromosome:RGSC3.4:2:140546939:140568616:1 gene:ENSRNOG00000013296 transcript:ENSRNOT00000017785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSSLVCAVSLLCACQQSYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFY
SVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTV
LAVLGVASRFLDEYLDFHVAKKLKRPF
Download sequence
Identical sequences ENSRNOP00000017785 10116.ENSRNOP00000017785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]