SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017858 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017858
Domain Number 1 Region: 50-500
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.57e-144
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 701-779
Classification Level Classification E-value
Superfamily PA domain 0.0000000288
Family PA domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017858   Gene: ENSRNOG00000028358   Transcript: ENSRNOT00000017858
Sequence length 932
Comment pep:known chromosome:RGSC3.4:13:66653925:66712432:1 gene:ENSRNOG00000028358 transcript:ENSRNOT00000017858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGGGRGCGCRVPQRASWSLVAATAALYLMLATTVCTAGAAPMSREEKQKLGNQVLEM
FDHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNK
TKEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDEL
LQMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAAL
SRFTGATVFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYL
LKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQ
VLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGD
PYYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKED
IIFDIEDYIFTTEAHLLPLWLSTTNRNISKKNTTSEYTELDDSNFDWTCPNTQILFPNDP
LYAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSL
IHLKDGRVQLVQHAIQAASSVDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIISHPFFG
RVVLTAGPAQFGLDLSKHKETRGFVASSKPYNGCSELTNPEAVMGKIALIQRGQCMFAEK
ARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAI
REHEQVEVLLSDKARDRDPEVENEDQPSSENDSQNQSAEQMLPLPQTVGLADQESPGNPL
ESPSEPPSPADSEEAAGFAPSEQISSPTETQETAGLDGECTDLDNQLQDQPETEEDPSPN
VSWGTKAQPMDSILADWNEDIEAFEMMEKDEL
Download sequence
Identical sequences NP_001178600.1.100692 NP_001178600.1.4139 ENSRNOP00000017858 10116.ENSRNOP00000017858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]