SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017928 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017928
Domain Number 1 Region: 477-604
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000404
Family YlbA-like 0.064
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000017928
Domain Number - Region: 16-68
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0211
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017928   Gene: ENSRNOG00000012975   Transcript: ENSRNOT00000017927
Sequence length 758
Comment pep:known chromosome:RGSC3.4:4:105719323:105735036:1 gene:ENSRNOG00000012975 transcript:ENSRNOT00000017927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVHRGSARAAPASDKVQKNKPAQTSGLKQGSRMAKIFGFEWADLSSWQSVVTLLNRPTD
PANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYT
IMFLGALGMMLGLWYRLSCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYW
SVDGLLSAQKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVEGYSMEHLSRHWLFSP
FKLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPIGLVFVSYFHCMNSQLFSIGMFP
YVMLASSPLFCSAEWPRKLVARCPKRLQELLPAKAAPRPSASCVYKRARAKAGQKPGLRH
HLGAVFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGLT
GELGYLNPGVFTQSRRWKDHADMLKQYATCLSLLLPKYNVTEPQIYFDIWVSINDRFQQR
LFDPRVDIVQAVWSPFRRTPWVQPLLMDLSPWRTKLQDIKSSLDNHTEVVFIADFPGLHL
ENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTVSSSPSCYM
YVYVNTTEVALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFL
RRQRKLQEIERRRNSPLHERFLRFVLRKLYVFRRSFLMTRISLRNLLFGRPSLEQLAQEV
TYANLRPFEPVDESSASNTDSSDPHPSEPDSEHVHSEL
Download sequence
Identical sequences B5DEF3
ENSRNOP00000017928 10116.ENSRNOP00000017928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]