SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017937 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017937
Domain Number 1 Region: 409-517
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.052
Further Details:      
 
Domain Number 2 Region: 168-262
Classification Level Classification E-value
Superfamily PDZ domain-like 2.8e-24
Family PDZ domain 0.0062
Further Details:      
 
Domain Number 3 Region: 2539-2637
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-24
Family Interleukin 16 0.003
Further Details:      
 
Domain Number 4 Region: 2422-2511
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family Interleukin 16 0.0043
Further Details:      
 
Domain Number 5 Region: 565-661
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017937   Gene: ENSRNOG00000013140   Transcript: ENSRNOT00000017937
Sequence length 2640
Comment pep:known chromosome:RGSC3.4:2:61828127:61936182:-1 gene:ENSRNOG00000013140 transcript:ENSRNOT00000017937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLAEQCWNGGFIYLIMLRRFKQKAHVTYNGNSGNSSEPGETPTLELGDQTSKKGKRTRK
FGVISRPSISKTPEDSKSSSGCDTADDPNSELENGADPELGNGHAFELENGPHSLKDVAG
PHLERSEADSEVELRVPKTEAPLSDSNDKRRFSKTGKTDFQSSDCLAREEVGRIWKMELL
KESDGLGIQVSGGRGSKRSPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHE
EAVAILRSATGMVQLVVASKESSAEDLLKLTSKSLPDLTSSVEDMSSWTDNEDQEAAGED
EEGSGPAAVRVTMPGSEESQDVGSSEESKGNLESPKQGNCKTKLKSRLSGGVHRLESVEE
YNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDSTGTSQEYHIVKKSTRSLSTTHVESPWR
LIRPSVISIIGLYKEKGKGLGFSIAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEI
LDVNGIPIKGLTFQEAIHTFKQIRSGLFVLTVRTKLLSPSLTPCSTPTHMSRSSSPSFNT
NSGGTPAGGGQEEGGSSSLGRKAPGPKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGI
YIHSLAPGSVAKMESNLSRGDQILEVNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPN
PKVSEQEMDEVIARSTYQESREANSSPGLGTPLKSPSLAKKDSLLSESELSQYFVHDGQG
SLSDFVVAGSEDEDHPGSGYETSEDGSLLPVPSGYRATHKARANSLVTLGSQRTSGLLHK
QVTVARQASLPGSPQVLRNPLLRQRRVRCYDSNGGSDDEDFDGEGDCISLPGVLPGPGKP
LVEDDTRPALTTSSKSIDVNKQEERLQKPLVSKACSVPLLGSSLDSEHSILNGTGGTPPK
VASLPGSGETPKNGPRGSGRKEMSGSRSSPKLEYRVPTDTQSPRSPENHTSPPQKSENLV
SRHKPVARISPHYKRSDAEEAPGGTANGPCAQDLKVQASPVKDPVTGRQPGGTAEKELQG
NPTPGDSSVPTNCGPASTPCHPNTGLPTENPQGAAPECVPHPGTGWDGSSEHLCSPGKSR
EVHPDSSETPTVAEQVHQPESLSQPVSPRTSEPESQGISKMKPPSQRCVSPREKASTPPD
SSRAWAAPGDSSPSTRRIAVPMSTGAAPATAIPQASLVSQERSRGLSGPSKGLGTKELCI
PKSLKDGALLEDTAPASGKMSHASSPSGPVATERTLSGSPENPVTDIDNFIEEASEARLS
QSPQKADCRAHGDTFESQPPGGAGSSSSHHGKTGGTGSPPPQQWALQPSVLDSIHPDKHL
AVNKTFLNNYSRNFSNFHEGGSSEPSPSSMYGNAEDSSSDPESLAEDPGAAARNNWSPPL
SPESSPKEGSSESEDERIEICSTDGCPGTPVTAPPPTQVALCPVLPVQQRAVCKPVGDIC
ERACFVPGASRTSIPDSSQPFSFLDVSSEEPETWASINASQNHMPVCTEGIMDVTSTSSN
MGDSQSSQMTRHCRNAPFVLGNPDMVNDLGRDLLDEGAPKEGAAAASVMRSVFALGAEGP
KNGEAVLADLHIAERGNLEDLLQKPKTISRRPILTWFKEINKDSQGSHLRSTSEKEQSSM
LALGPGSKANMVNTGHRKGVTVPKSPPSRQKSQENKDLPPKSPVETLGNCQKPKCSPKLK
RLNSKGKASPEVPVAISTKGSRNDHRKTLPSPQASHKMFSKAVSHRLHIADQEEPKNTAG
DTPKPPQCVPESKPPQAALGSLRTSASDTSIRTFTSPLTSPKLLPEQGANSRFHMAVYLE
SDTSCPTTSRSPRSGPEGKAPHANSGSASPPASRASLALAGIRQSKQFTPGRADLLVSEA
TQPQGICEKGAEKKVSDPPQRTNQLKIVEISSERVPKNACGDRPPESDRKGGFLTQNNCQ
EKSAIRLRQSEESSPEHTPFPPSQASQVEREIRWSFSMAKPATSSSSSLQLPAKLPESFQ
GKSSQMPASVGVPKNGVPIGLAGEESPYFTPRPATRTYSMPAQFSSHFGREGPSPHSPSH
SPQDPQVPAMGGKLSEKTAKGVTNGQGVYSVKPLLETSKNLSPVDGRDVSADPETSCLIP
DKVKVTRRQYCCEQSWPHESTSFFSVKQRIKSFENLANSDRPTAKCATSPFLSVSSKPPI
NRRSSGSIPSGSPSDMTSRSLRRSLSSCSESQSEASSLLPQMTKSPSSMTLTVSRQNPPD
TSNKGPSPDPKKSLVPVGIPTSTVSPASPSKRNKSSVRHAQPSPVSRSKLQELRTLSMPD
LDKLCNGEDDSASPGAVLFKTQLEITPRRSKGSQATSPAGSPARGHADFNGSTFLSCPMN
GGTRAYTKGTSEPAIATGSREEGESVWATPSGKSWSVSLDRLLASVGNQQRLQGILSLVG
SKSPILTLIQEAKAQSETKEDICFIVLNKKEGSGLGFSVAGGADVEPKSVMVHRVFSQGV
ASQEGTVSRGDFLLSVNGTSLAGLAHSEVTKVLHQAELHKHALMIIKKGNDQPGPSFKQE
PPSANGKGPFPRRTLPLEPGAGRNGAAHDALCVEVLKTSAGLGLSLDGGKSSVSGEGPLV
IKRVYKGGAAERAGTIEAGDEILAINGKPLVGLVHFDAWNIMKSVPEGPVQLVIRKHRDS
Download sequence
Identical sequences 10116.ENSRNOP00000056539 ENSRNOP00000017937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]