SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017989 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017989
Domain Number 1 Region: 36-415
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.44e-131
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.000000000000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017989   Gene: ENSRNOG00000013030   Transcript: ENSRNOT00000017989
Sequence length 416
Comment pep:known chromosome:RGSC3.4:10:86464211:86490407:-1 gene:ENSRNOG00000013030 transcript:ENSRNOT00000017989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLRVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEETEVED
RAEEEECENDGVGGGLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESAPKK
EVYFMAIIDILTPYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
Download sequence
Identical sequences O88377
ENSRNOP00000017989 NP_446002.1.100692 NP_446002.1.4139 10116.ENSRNOP00000017989 ENSRNOP00000017989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]