SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018091 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018091
Domain Number 1 Region: 37-267
Classification Level Classification E-value
Superfamily Aquaporin-like 2.88e-36
Family Aquaporin-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018091   Gene: ENSRNOG00000013358   Transcript: ENSRNOT00000018091
Sequence length 271
Comment pep:known chromosome:RGSC3.4:1:154973798:154983989:-1 gene:ENSRNOG00000013358 transcript:ENSRNOT00000018091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLGLPPEVQDTCISLGLMLLVVLFMGLARVIARQQLHRPMVHAFVLEFLATFQLCYC
THELQLLSEQDSGHPTWTLTLIYFFSLVHGLTLVGTASNPCGVMMQMILGGMSPEMGAVR
LMAQLVSALCSRYCISALWSLSLTKYHFDERILACRNPINTDISKAIIIEAICSFIFHSA
LLHFQEVRTKLRIHVLAALITFLAYAGGSLTGALFNPALALSLHFPCFDESFYKFFVVYW
VAPSLGVLLMILMFSFFLPWLHNNQLSNKKE
Download sequence
Identical sequences Q8CHM1
ENSRNOP00000018091 ENSRNOP00000018091 10116.ENSRNOP00000018091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]