SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018194 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018194
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 4.49e-40
Family UEV domain 0.000000409
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000018194
Domain Number - Region: 244-311
Classification Level Classification E-value
Superfamily Tropomyosin 0.049
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018194   Gene: ENSRNOG00000013381   Transcript: ENSRNOT00000018194
Sequence length 391
Comment pep:known chromosome:RGSC3.4:1:97445044:97475100:-1 gene:ENSRNOG00000013381 transcript:ENSRNOT00000018194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMMSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIP
VRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHP
RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTAAGPPNTSYLPSMPSGISAYPSGYP
PNPRSWPGPQPPKCGVYRGVTSSTHVSVPPLITTGPSRDGTISEDTIRASLISAVSDKLR
WRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSRNOP00000018194 10116.ENSRNOP00000018194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]