SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018558 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018558
Domain Number 1 Region: 7-85
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-19
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 2 Region: 367-431
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 308-371
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.24e-17
Family LIM domain 0.039
Further Details:      
 
Domain Number 4 Region: 278-306
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000844
Family LIM domain 0.0049
Further Details:      
 
Domain Number 5 Region: 427-452
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000422
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018558   Gene: ENSRNOG00000013653   Transcript: ENSRNOT00000018558
Sequence length 457
Comment pep:known chromosome:RGSC3.4:17:15168833:15175327:1 gene:ENSRNOG00000013653 transcript:ENSRNOT00000018558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPAQSKPQKALTPPADPPRYTFAPSASLNKTARPFG
APPPTDSALSQNGQLLRQLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEFMKKSSQVPRTEAPAPASTIPQESWPGPTTPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQNRTSIVQAAAGGGTGGGSNNGKTPVCHQCHKIIRGRYLVALGHA
YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPSCAKCKKKITGEIMHALKMTW
HVPCFTCAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFS
WHDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
Download sequence
Identical sequences Q9Z1Z9
RnR303 10116.ENSRNOP00000018899 ENSRNOP00000018899 NP_775148.1.100692 NP_775148.1.4139 XP_017455959.1.100692 ENSRNOP00000018558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]