SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000018696 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000018696
Domain Number 1 Region: 404-676
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.83e-93
Family Inositol polyphosphate kinase (IPK) 0.00000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000018696   Gene: ENSRNOG00000013945   Transcript: ENSRNOT00000018696
Sequence length 678
Comment pep:known chromosome:RGSC3.4:1:82284848:82306668:-1 gene:ENSRNOG00000013945 transcript:ENSRNOT00000018696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCPCRGSLSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPEGGGPRA
WIEGFSLHSEAERTDFGPAPCPDGPQAEPCGDEHEECEAAGLGVASEKPSQNKELDGSNL
QTHPKLSSPLAEMEMAGSWTDGFRTDLHRPDLQARPKRASLCTQPGFDESWTELDRSELW
QTLPERDKPWVDHLRTHQDMSRLQNHPACPSPEPSAGTSCKELSADGSRTPHDTDGFWIE
SQTDGSLIGPSTQTACRQPANDGFSAQDTDGTLIQPGTDDGPWVDSVLEKSNGDDPLMEP
EPRDLVTNLCSHLECSSLCPVPRLIITSESPEPGAQPLGPQARIEGGTGGFSSASSFDES
EDDLVAGGGGTSDPEDRSGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQLSGHAGNFQAGE
DGRILKRFCQCEQRSLELLMGDPLRPFVPTYYGMVQRDGQAFNQMEDLLADFEGPSIMDC
KMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETLS
STSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVNGDVGILRKYVARLEDLRDT
LENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQMLSHRLPWAEGNREDG
YLWGLDNLICLLQGLAQS
Download sequence
Identical sequences Q80ZG2
ENSRNOP00000018696 10116.ENSRNOP00000018696 NP_835195.1.100692 NP_835195.1.4139 ENSRNOP00000018696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]