SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019140 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019140
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.55e-32
Family Putative zinc binding domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019140   Gene: ENSRNOG00000014284   Transcript: ENSRNOT00000019140
Sequence length 83
Comment pep:known chromosome:RGSC3.4:8:21225264:21231059:-1 gene:ENSRNOG00000014284 transcript:ENSRNOT00000019140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTP
ITYLSEPVDVYSDWIDACEAANQ
Download sequence
Identical sequences A0A0D9R323 A0A1A6HLS4 A0A1S2ZXA6 A0A1S3GKU6 A0A1U7R0L6 A0A1U7RHG1 A0A1U7SRA8 A0A218U8H4 A0A250Y8M9 A0A286XTP5 A0A2I2UAP4 A0A2I2YUF0 A0A2I3TW88 A0A2K5JL24 A0A2K5KXX2 A0A2K5RSX9 A0A2K5ZUQ8 A0A2K6D1M8 A0A2K6G869 A0A2K6L8S5 A0A2K6U2P5 A4IFR3 D2I6N2 D4AEE9 F2Z5J7 F6S1H1 F7ABX0 F7C8K1 F7F290 G1P5D7 G3H692 G3SNQ9 G5AJT6 G7PZF7 H0XI60 H2P0J3 H9ZED7 I3M2R3 L5L429 L8IXR4 L8YCZ2 M3Y0L7 P60002 P60003 Q545S6 S7MMC3 W5QBB9 W6FF95
ENSSSCP00000014467 ENSEEUP00000004845 HR2613 ENSNLEP00000015312 ENSMLUP00000005216 ENSGGOP00000004119 ENSAMEP00000000063 ENSOANP00000018928 ENSSSCP00000014467 ENSLAFP00000001279 ENSTTRP00000001702 ENSCJAP00000010085 ENSPTRP00000017929 ENSMUSP00000013966 ENSMUSP00000128173 ENSECAP00000010571 NP_001098978.1.59421 NP_001098978.1.76553 NP_001119570.1.100692 NP_001119570.1.4139 NP_001177831.1.72884 NP_115753.1.87134 NP_115753.1.92137 NP_740747.1.92730 XP_001363744.1.35504 XP_001490391.2.31192 XP_001510953.1.37387 XP_002761845.2.60252 XP_002834487.1.23681 XP_002930876.1.58354 XP_003123238.2.46622 XP_003413127.1.64505 XP_003432819.1.84170 XP_003461296.1.53824 XP_003499759.1.69978 XP_003797980.1.62490 XP_003830560.1.60992 XP_003830561.1.60992 XP_004008597.1.66739 XP_004089362.1.23891 XP_004089363.1.23891 XP_004089364.1.23891 XP_004277454.1.21590 XP_004316058.1.83887 XP_004378369.1.4749 XP_004398972.1.74151 XP_004398973.1.74151 XP_004442723.1.5094 XP_004595574.1.84141 XP_004616648.1.94378 XP_004632868.1.9945 XP_004667542.1.11716 XP_004716840.1.18182 XP_004748431.1.14098 XP_004748432.1.14098 XP_004865664.1.39548 XP_005078574.1.91757 XP_005281405.1.60341 XP_005336238.1.77405 XP_005336239.1.77405 XP_005336240.1.77405 XP_005347003.1.66349 XP_005405731.1.28644 XP_005588119.1.63531 XP_005588120.1.63531 XP_005632903.1.84170 XP_005654841.1.46622 XP_005682449.1.57651 XP_005861419.1.60319 XP_005890824.1.15283 XP_005970337.1.78601 XP_005970338.1.78601 XP_006023491.1.24877 XP_006023492.1.24877 XP_006063941.1.26621 XP_006063942.1.26621 XP_006104614.1.53796 XP_006104615.1.53796 XP_006124810.1.96668 XP_006161036.1.99106 XP_006184944.1.101512 XP_006206374.1.17985 XP_006744343.1.47382 XP_006744344.1.47382 XP_006765874.1.95426 XP_006875209.1.41390 XP_006898861.1.29581 XP_006905899.1.64745 XP_006905900.1.64745 XP_006928505.1.62641 XP_006928506.1.62641 XP_006982425.1.50099 XP_006982426.1.50099 XP_007058265.1.26238 XP_007106712.1.24612 XP_007106713.1.24612 XP_007168974.1.59432 XP_007168975.1.59432 XP_007460777.1.90284 XP_007526037.1.11023 XP_007625054.1.28591 XP_007625055.1.28591 XP_007638636.1.69978 XP_007951807.1.48129 XP_007993524.1.81039 XP_008046698.1.4292 XP_008156233.1.99482 XP_008535583.1.77740 XP_008584750.1.73410 XP_008706282.1.72690 XP_008706283.1.72690 XP_008706284.1.72690 XP_008764209.1.100692 XP_008764210.1.100692 XP_008764211.1.100692 XP_008831832.1.79516 XP_008831833.1.79516 XP_008985559.1.60252 XP_010327807.1.74449 XP_010359992.1.97406 XP_010591623.1.64505 XP_010591624.1.64505 XP_010633043.1.5607 XP_010826610.1.44457 XP_010826611.1.44457 XP_010965151.1.22495 XP_010976582.1.51371 XP_011216020.1.58354 XP_011287535.1.62641 XP_011378637.1.92234 XP_011378638.1.92234 XP_011722107.1.29376 XP_011722170.1.29376 XP_011722231.1.29376 XP_011810175.1.43180 XP_011810176.1.43180 XP_011849439.1.47321 XP_011849441.1.47321 XP_011849442.1.47321 XP_011849443.1.47321 XP_011849444.1.47321 XP_011849445.1.47321 XP_011849446.1.47321 XP_011849447.1.47321 XP_011949291.1.92194 XP_011949292.1.92194 XP_011991550.1.54773 XP_011991553.1.54773 XP_011991554.1.54773 XP_012033328.1.66739 XP_012291760.1.9421 XP_012291761.1.9421 XP_012391278.1.21590 XP_012397334.1.9362 XP_012496800.1.63892 XP_012496801.1.63892 XP_012584788.1.23501 XP_012584789.1.23501 XP_012584790.1.23501 XP_012584791.1.23501 XP_012584792.1.23501 XP_012584793.1.23501 XP_012584794.1.23501 XP_012584795.1.23501 XP_012646014.1.48125 XP_012646015.1.48125 XP_012646016.1.48125 XP_012646017.1.48125 XP_012646018.1.48125 XP_012646019.1.48125 XP_012889431.1.60039 XP_013218725.1.77405 XP_013360570.1.28644 XP_013360571.1.28644 XP_013842829.1.46622 XP_013842830.1.46622 XP_013842831.1.46622 XP_013842832.1.46622 XP_013842833.1.46622 XP_014332187.1.15283 XP_014332188.1.15283 XP_014448141.1.99106 XP_014461176.1.47583 XP_014720956.1.49734 XP_014720957.1.49734 XP_014747782.1.99236 XP_014978405.1.72884 XP_014978406.1.72884 XP_014978407.1.72884 XP_015327474.1.76553 XP_015327475.1.76553 XP_015344549.1.40921 XP_015344550.1.40921 XP_015344551.1.40921 XP_015344552.1.40921 XP_015344553.1.40921 XP_015344554.1.40921 XP_015344555.1.40921 XP_015344556.1.40921 XP_015344557.1.40921 XP_015856399.1.50099 XP_016009128.1.101085 XP_016009129.1.101085 XP_016009130.1.101085 XP_016063357.1.3490 XP_016063358.1.3490 XP_016287420.1.35504 XP_016790609.1.37143 XP_016790610.1.37143 XP_016882847.1.92137 XP_016882848.1.92137 XP_017168995.1.92730 XP_017168996.1.92730 XP_017168997.1.92730 XP_017353195.1.71028 XP_017353196.1.71028 XP_017353197.1.71028 XP_017518968.1.32401 XP_017724912.1.44346 XP_017724914.1.44346 XP_017724915.1.44346 XP_017906619.1.57651 XP_017906620.1.57651 XP_018871565.1.27298 XP_019283166.1.44245 XP_019343730.1.47583 XP_019514854.1.44202 XP_019514855.1.44202 XP_019514856.1.44202 XP_019600585.1.88060 XP_019600587.1.88060 XP_019600588.1.88060 XP_019600589.1.88060 XP_019673469.1.62641 XP_020028864.1.5219 XP_020028865.1.5219 XP_020028867.1.5219 XP_020028868.1.5219 XP_020647350.1.8467 XP_020647351.1.8467 XP_020749965.1.74333 XP_020749967.1.74333 XP_020749968.1.74333 XP_020851039.1.61212 XP_020939541.1.46622 XP_021063203.1.100879 XP_021406034.1.53032 XP_021499499.1.76796 XP_021560672.1.83697 XP_021560673.1.83697 XP_021560674.1.83697 XP_021560675.1.83697 XP_021560676.1.83697 XP_021589557.1.77405 ENSMMUP00000001960 ENSP00000252445 ENSP00000467264 ENSP00000467914 ENSCPOP00000018833 ENSOGAP00000015800 ENSLAFP00000001279 ENSTTRP00000001702 ENSCPOP00000018833 ENSBTAP00000052837 ENSMEUP00000011008 ENSPTRP00000017929 ENSCJAP00000010085 ENSNLEP00000015312 ENSAMEP00000000063 ENSMLUP00000005216 ENSRNOP00000019140 ENSGGOP00000004119 ENSBTAP00000052837 ENSOANP00000018928 ENSECAP00000010571 ENSMUSP00000013966 ENSRNOP00000019140 ENSMPUP00000004868 ENSMPUP00000004868 ENSMODP00000008292 ENSTBEP00000004126 ENSSTOP00000003296 ENSPPYP00000011793 ENSFCAP00000004554 ENSMODP00000008292 10090.ENSMUSP00000013966 10116.ENSRNOP00000019140 10141.ENSCPOP00000018833 13616.ENSMODP00000008292 9258.ENSOANP00000018928 9544.ENSMMUP00000001960 9598.ENSPTRP00000017929 9600.ENSPPYP00000011793 9606.ENSP00000252445 9615.ENSCAFP00000025525 9685.ENSFCAP00000004554 9796.ENSECAP00000010571 9823.ENSSSCP00000014467 ENSEEUP00000004845 ENSOARP00000020016 ENSMUSP00000013966 ENSMMUP00000001960 HGL_H00000252445 ENSTBEP00000004126 ENSPPYP00000011793 gi|14150203|ref|NP_115753.1| ENSPVAP00000014045 ENSP00000252445 ENSP00000467264 ENSP00000467914 ENSPANP00000002852 ENSMEUP00000011008 ENSFCAP00000004554 ENSSTOP00000003296 ENSPVAP00000014045 ENSOGAP00000015800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]