SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019244 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019244
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-79
Family FCH domain 0.00000000871
Further Details:      
 
Domain Number 2 Region: 522-595
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000019244
Domain Number - Region: 405-468
Classification Level Classification E-value
Superfamily HR1 repeat 0.0222
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019244   Gene: ENSRNOG00000013798   Transcript: ENSRNOT00000019244
Sequence length 609
Comment pep:known chromosome:RGSC3.4:2:219200341:219251797:-1 gene:ENSRNOG00000013798 transcript:ENSRNOT00000019244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGR
KAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTH
MADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKV
IPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTVSDGTIS
ASKQEGGKMDSKSTAGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSPPNGSQFLTLSIEPV
HYCMNEIKTGKPRIPSFRSLKRGWSMKMGPALEDFSHLPPEQRRKKLQQRIDELNRGLQK
ESDQKEALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTG
VRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAI
GHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTTYIDVTLEK
NSKGAVTYI
Download sequence
Identical sequences NP_001034698.1.100692 NP_001034698.1.4139 ENSRNOP00000019244 10116.ENSRNOP00000063729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]