SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019829 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019829
Domain Number 1 Region: 66-129
Classification Level Classification E-value
Superfamily BPTI-like 4.11e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 2 Region: 31-72
Classification Level Classification E-value
Superfamily Elafin-like 0.000000011
Family Elafin-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019829   Gene: ENSRNOG00000028908   Transcript: ENSRNOT00000019829
Sequence length 134
Comment pep:known chromosome:RGSC3.4:3:155607326:155614193:-1 gene:ENSRNOG00000028908 transcript:ENSRNOT00000019829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSRFVSILVLFGLLTKVQGPSLTDFLFPRRCPRFREECEHRERDLCTRDRDCQKREKC
CIFSCGKKCLNPQQDICSLPKDSGYCMAYFPRWWYNKKNGTCQLFIYGGCQGNNNNFQSQ
SICQNACEKKSNST
Download sequence
Identical sequences D4A2Z2
10116.ENSRNOP00000019829 ENSRNOP00000019829 ENSRNOP00000019829 NP_001102927.1.100692 NP_001102927.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]