SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019849 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019849
Domain Number 1 Region: 32-92
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019849   Gene: ENSRNOG00000014794   Transcript: ENSRNOT00000019849
Sequence length 159
Comment pep:known chromosome:RGSC3.4:3:155712895:155715698:1 gene:ENSRNOG00000014794 transcript:ENSRNOT00000019849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKLGFLLGFSLFCLLSPPVLSFVEKVAARLCKEFNDPCALEMDPGSCYESHYRFFYN
QTSKKCQIFVFSGCNGNRNNFMLKIDCDVMCNEEYKVKPQSLGCKEDRPIKASNSQETRS
HLRVTSPQPGGLKQTERKPTGRQRARRESGRQPLARHHA
Download sequence
Identical sequences ENSRNOP00000019849 ENSRNOP00000019849 10116.ENSRNOP00000019849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]