SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000019939 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000019939
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily Aquaporin-like 1.31e-59
Family Aquaporin-like 0.0000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000019939   Gene: ENSRNOG00000014652   Transcript: ENSRNOT00000019939
Sequence length 263
Comment pep:known chromosome:RGSC3.4:1:182331494:182337291:1 gene:ENSRNOG00000014652 transcript:ENSRNOT00000019939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEQTPMCSMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIE
NSPNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQL
FGGMIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAVN
EKTMGPLAPFSIGFSVIVDILAGGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAG
LFVGLLIRLFIGDEKTRLILKSR
Download sequence
Identical sequences P56405
10116.ENSRNOP00000019939 NP_062031.1.100692 NP_062031.1.4139 ENSRNOP00000019939 ENSRNOP00000019939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]