SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020123 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020123
Domain Number 1 Region: 457-622
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-56
Family Phosphotyrosine-binding domain (PTB) 0.0000000583
Further Details:      
 
Domain Number 2 Region: 636-759
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 751-835
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-16
Family PDZ domain 0.0000181
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000020123
Domain Number - Region: 42-47
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020123   Gene: ENSRNOG00000014928   Transcript: ENSRNOT00000020123
Sequence length 842
Comment pep:known chromosome:RGSC3.4:1:227106828:227309417:1 gene:ENSRNOG00000014928 transcript:ENSRNOT00000020123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPQPSPPPPAGHAPEDHRAHPA
PPPPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESA
YAVQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHR
AEDEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHH
YDERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAE
QDLERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEA
IEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSI
TPLHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKT
PSKNVRMMQAQEAVSRIKQTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQE
PMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESE
DAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCK
DVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLV
GLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGG
IAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPV
YI
Download sequence
Identical sequences 10116.ENSRNOP00000020123 ENSRNOP00000020123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]