SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020214 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020214
Domain Number 1 Region: 184-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-85
Family Protein kinases, catalytic subunit 0.000000222
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.21e-42
Family Regulator of G-protein signaling, RGS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020214   Gene: ENSRNOG00000014615   Transcript: ENSRNOT00000020214
Sequence length 589
Comment pep:known chromosome:RGSC3.4:17:15221264:15236617:-1 gene:ENSRNOG00000014615 transcript:ENSRNOT00000020214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVAEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPE
VPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSMAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSPQARSLC
SQLLNKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPTAPPKKGLLQRLFSRQRIAVGTAATVKKSSPPASSPQAEAPTGGWR
Download sequence
Identical sequences A0A0G2K6E5
ENSRNOP00000020214 NP_113845.2.100692 NP_113845.2.4139 10116.ENSRNOP00000020214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]