SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020466 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020466
Domain Number 1 Region: 42-434,462-488
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.52e-58
Family Cystathionine synthase-like 0.00094
Further Details:      
 
Domain Number 2 Region: 572-702
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 2.62e-39
Family MOSC N-terminal domain-like 0.00086
Further Details:      
 
Domain Number 3 Region: 571-618,727-832
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000188
Family MOSC (MOCO sulphurase C-terminal) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020466   Gene: ENSRNOG00000015113   Transcript: ENSRNOT00000020466
Sequence length 862
Comment pep:known chromosome:RGSC3.4:18:16420503:16466040:1 gene:ENSRNOG00000015113 transcript:ENSRNOT00000020466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGATERGPEPPAFQRHPEASAPRLAHGYGLRSMSELRDQEFGRLAGTVYLDHAGATLF
PQSQLTNFTKDLMENVYGNPHSQNITSKLTHDTVEQVRYRVLTHFHTTPEDYSVIFTAGS
TAALRLVAETFPWVSRSPENSGSHFCYLTDNHTSVVGMRTVAATMNVTSTPVKPEDMWSA
EGKGAGACDPDCQLPHLFCYPAQSNFSGTRYPLSWIDEVKSGQRSPVRAPGKWFVLLDAA
SYVSTSPLDLSAHQADFIPISFYKIFGLPTGLGALLVNKRVAPLLRKGYFGGGTAAVYLA
GEDFYIPRSSVAERFEDGTISFLDVIALKHGFDVLERLTGGMVNIQQHTFALLHFTHSAL
SSLRYPNGAPVVRIYGDSGFSSPDVQGPIINFNVLDDAGKIIGYSQVDKMASLYNIHLRT
GCFCNLGACQRHLGLSEEMVKKHFQAGHVCGDDVDIIDGRPTGSVRISFGYMSTLEDAQA
FLRFISTIYLRSPGGQPVPQASTSDTGVLSSKSDCQSPQEGPCADPAVSSGSYPDINTVD
LDLSQSKASSIQPIPQEKVAGILNGDLGSHIVTNIYLYPIKSCAAFEVTKWPVGSQGLLY
DRSWMVVNHNGVCLSQKQEPRLCLIQPCIDLQQKVMVIKAEGMEPIQVPLEEDGERTQIC
QSRVCADRVNTYDCGENVSRWLSKFCGRPCHLIKQSPHFQRNAKKTPKQGHPPGTAVALS
LVNEAQYLLVNTSSVLELQQQLNASDERGKEESFSVKDLISRFRANIITKGARAFEEEQW
DEISIGSLHFQVLGPCHRCQMICIDQKTGQRNQDVFQKLSESRGRKVNFGVYLMHSSLDL
SSPCFLSVGSEVLPVLKDCGVS
Download sequence
Identical sequences A0A1W2Q693
XP_006254528.1.100692 10116.ENSRNOP00000020466 ENSRNOP00000020466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]