SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020550 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020550
Domain Number 1 Region: 22-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.58e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020550   Gene: ENSRNOG00000015232   Transcript: ENSRNOT00000020550
Sequence length 539
Comment pep:known chromosome:RGSC3.4:1:227748131:227961671:-1 gene:ENSRNOG00000015232 transcript:ENSRNOT00000020550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTAENGDAVPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEEEPLQNAPDAKRPGMQ
KVLYSTAMESIQGPGKSADGIIAENPDTMGGIPAKSHKGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEILSSISQEWKDEKQDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVGEHYPHDRTTLYSNSKGLPSSSTFTLEEGTIYLTAEPNALETQDDASVLDVYL
Download sequence
Identical sequences Q5CZZ9
10116.ENSRNOP00000063506 NP_001012761.1.100692 NP_001012761.1.4139 XP_017444762.1.100692 ENSRNOP00000020550 ENSRNOP00000063506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]