SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020604 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020604
Domain Number 1 Region: 162-258
Classification Level Classification E-value
Superfamily PDZ domain-like 4.91e-19
Family PDZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020604   Gene: ENSRNOG00000015247   Transcript: ENSRNOT00000020604
Sequence length 333
Comment pep:known chromosome:RGSC3.4:1:250093822:250095472:-1 gene:ENSRNOG00000015247 transcript:ENSRNOT00000020604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLGGLKVSLGASAPHHKGIPPLQDVPVDAFSLRRGACAPPPQPPPVAPRPPRPNWLLTE
PPSREDTQQNQNQTPGQSCSRSRSHSRSRSGSRSRSKSAGCRRSPSPAPITTATSANGRY
HRPRKARPLLPRPLDGQVAKVGVRQEPLENGIDQTAEDEAGNATTGELRTVTLSKMKQSL
GISISGGIESKVQPMVKIEKIFPGGAAFLCRALQAGFELVAVDGESLEQVTHQRAVDTIR
RAYRNKAREPMELVVRVPGPGLLPLSSNLRAIKGQGLAADSSSAHGPIEDTPILTQLPPT
EARQLRHALSSVQKVPQSTPKLFPIHKDPHNPS
Download sequence
Identical sequences 10116.ENSRNOP00000020604 ENSRNOP00000020604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]