SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020717 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020717
Domain Number 1 Region: 760-987
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-58
Family DBL homology domain (DH-domain) 0.000000000966
Further Details:      
 
Domain Number 2 Region: 366-542
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-52
Family Regulator of G-protein signaling, RGS 0.0000000495
Further Details:      
 
Domain Number 3 Region: 991-1125
Classification Level Classification E-value
Superfamily PH domain-like 7.74e-41
Family Pleckstrin-homology domain (PH domain) 0.000000374
Further Details:      
 
Domain Number 4 Region: 41-134
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000020717
Domain Number - Region: 165-176,209-243
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00942
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020717   Gene: ENSRNOG00000015026   Transcript: ENSRNOT00000020717
Sequence length 1565
Comment pep:known chromosome:RGSC3.4:2:179676236:179796785:1 gene:ENSRNOG00000015026 transcript:ENSRNOT00000020717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRLPHSIDRSASKKQSHLSSPIASWLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLV
QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLE
VVKLIKSGAYAALTLLGSSPPSVGVSGLQQNPSVAGVPRVNPIIPPPPPPPPLPPPQHIT
GPKPLQDPEVQKHATQILRNMLRQEEKELQRIYEVYSRNPASLLEEQMEGARRRVTQLQL
KIQQETGGLVDILPPCGETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLMNRNSVL
SDPGLDSPQTSPVILARVAQHHRRQGSDAALLPLNHQGIDQSPKPLIIGPEEDYDPGYFN
NESDIIFQDLEKLKSHPAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDI
WNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRT
LGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAG
IRLRESRSSCTAEKTQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILRYIGKPK
SSSQSIKPGNVRNIIQHFENSHQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSES
LKGREEMKRSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPK
MGRRSIESPNLGFCTDVILPHLLEDDLGQLSDLEPEPEVQNWQHTVGKDVVANLTQREID
RQEVINELFVTEASHLRTLRVLDLIFYQRMRKENLMPREELARLFPNLPELIEIHNSWCE
AMKKLREEGPIIRDISDLMLARFDGPAREELQQVAAQFCSYQSVALELIRTKQRKESRFQ
LFMQEAESHPQCRRLQLRDLIVSEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCR
EILKFVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTW
RISKDKTLDLQVLLLEDLVVLLQRQEERLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIR
SVATDKRAFFIICTSELGPPQIYELVALTSSDKNIWMELLEEAVQNATKHPGAAPIPIHP
SPPGSQEPAYQGSTSSRVEINDSEVYHTEKEPKKLPEGPGPEQRVQDKQLIAQGEPVQEE
DEEELRTLPRAPPSLDGENRGIRTRDPVLLALTGPLLMEGLADAALEDVENLRHLILWSL
LPGHTVKTQAAGEPEDDLTPTPSVVSITSHPWDPGSPGQAPTISDSTRLARPEGSQPEGE
DVAVSSLAHLPPRTRSSGVWDSPELDRNPAAEAASTEPAASYKVVRKVSLLPGGGVGAAK
VAGSNAIPDSGQSESELSEVEGGAQATGNCFYVSMPAGPLDSSTEPTGTPPSPSQCHSLP
AWPTEPQPYRGVRGGQCSSLVRRDVDVIFHTIEQLTIKLHRLKDMELAHRELLKSLGGES
SGGTTPVGSFHTEAARWTDYSLSPPAKEALASDSQNGQEQGSCPEEGSDIALEDSATDTA
VSPGP
Download sequence
Identical sequences ENSRNOP00000020717 10116.ENSRNOP00000063559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]