SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021442 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021442
Domain Number 1 Region: 23-269
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-70
Family Aquaporin-like 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021442   Gene: ENSRNOG00000015949   Transcript: ENSRNOT00000021442
Sequence length 295
Comment pep:known chromosome:RGSC3.4:8:75611488:75651646:-1 gene:ENSRNOG00000015949 transcript:ENSRNOT00000021442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEKDGAKKSLMQRLALKSRIAKETLSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITI
NIGFASAVVMALYVTFGISGGHINPAVSFAMCAFGRMEWFKFPFYVGAQFLGAFVGAATV
FGIYYDGLMAFAGGKLLVVGENATAFIFATYPAPFISTPGAFVDQVVSTMFLLLIVFAMF
DSRNLGVPRGLEPVVIGLLIIVLSCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTVG
NNFWWIPVVGPMIGAFLGGLIYILFIQMHHSKLDPDMKAEPSENNLEKHELSVIM
Download sequence
Identical sequences P56627
NP_075249.1.100692 NP_075249.1.4139 XP_006243424.1.100692 XP_008764558.1.100692 ENSRNOP00000021442 ENSRNOP00000021442 10116.ENSRNOP00000021442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]