SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021596 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021596
Domain Number 1 Region: 61-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-38
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 356-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.51e-32
Family Ras-binding domain, RBD 0.0000147
Further Details:      
 
Domain Number 3 Region: 300-369
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.01e-20
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021596   Gene: ENSRNOG00000015616   Transcript: ENSRNOT00000021596
Sequence length 544
Comment pep:known chromosome:RGSC3.4:17:15293100:15307162:-1 gene:ENSRNOG00000015616 transcript:ENSRNOT00000021596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELTSTSGSQAQGEGRGSSLSIHSLPSGPSSPFSTDEQP
VASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWQACERFQQIPASDTKQLAQEAHN
IYHEFLSSQALSPVNIDRQAWLSEEVLAQPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
QECLLAEAEGRPLREPGSSHLGSPDTARKKPKLKPGKSLPLGVEELGQLPLAEGRPLRKS
FRREMPGGAVNSALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSGEGESESRPGK
YCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGKEQKALVLDQDCTV
LADQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHRPGE
KQLVDLENLVSSVASQTLVLDTLPDAKTREASSIPPCRSQGCLPRTQTKDSHLPPLSSSL
SVEDASGSTGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPSQRPGSQ
EAPP
Download sequence
Identical sequences O08773
ENSRNOP00000021596 NP_446216.1.100692 NP_446216.1.4139 10116.ENSRNOP00000021596 ENSRNOP00000021596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]