SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021660 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021660
Domain Number 1 Region: 73-206,242-344
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.22e-61
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 9.55e-27
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021660   Gene: ENSRNOG00000016135   Transcript: ENSRNOT00000021660
Sequence length 472
Comment pep:known chromosome:RGSC3.4:17:34595256:35048596:-1 gene:ENSRNOG00000016135 transcript:ENSRNOT00000021660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCLAFIRAAHEHLYLVRKVSHVCRCHQHRAWGSRPAASQFAVQGAPGRVLELLGKSYPQ
DDHTNLTQKVLSKVGRNLHNQKFHPLWLIKERVKEHFYQQYMGRSRTPLFSVYDQLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNRGHMLRAHTSAHQWDLLHAGLNAFLVVGDVYRR
DQIDSQHYPVFHQLEGVRLFSKHELFAGVKDGESLQLFEESSRSAHKQETHTMEAVKLVE
FDLKQVLTRLVTHLFGDGLEVRWVDCYFPFTHPSFEMEINFRGEWLEVLGCGVMEQQLVN
SAGAQDRIGWAFGLGLERLAMVLYDIPDIRLFWSEDERFLKQFRLSDINQSVKFQRWFFQ
EERATGIQRKMGRQLCPFSKYPAVFNDISFWLPSENYTENDFYDIVRTVGGDLVEKVDLI
DKFEHPKTHRTSHCYRITYRHMERTLSQREVSSVHQAVQEAAVQLLGVEGRF
Download sequence
Identical sequences Q6AYQ3
NP_001013157.1.100692 NP_001013157.1.4139 ENSRNOP00000021660 10116.ENSRNOP00000021660 ENSRNOP00000021660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]