SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021715 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021715
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-37
Family Pleckstrin-homology domain (PH domain) 0.0000684
Further Details:      
 
Domain Number 2 Region: 72-178
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-25
Family PDZ domain 0.0000532
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000021715
Domain Number - Region: 306-400
Classification Level Classification E-value
Superfamily PH domain-like 0.0132
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021715   Gene: ENSRNOG00000016062   Transcript: ENSRNOT00000021715
Sequence length 503
Comment pep:known chromosome:RGSC3.4:3:144843681:144874238:-1 gene:ENSRNOG00000016062 transcript:ENSRNOT00000021715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRRAPRTGLLELRSGAGSGAGGERWQRVLLTLAEDALTVSPADGEPGPEPEPAQLNG
AAEPGAASPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQT
EALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVG
WDSPPASPLQRQPSSPGPQPRNLNEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDT
LFLRAKDEASARSWAGAIQAQISTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPS
GGTAPTLALLTEKELLLYCSLPQTREALSRPARTAPLIATSSAHRLVHSGPSKGSVPYDA
ELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCN
LSVHIDKGFTLWAAEPGATRAVLLRQPFEKLQMSSDDGMSLLFLDFGGAEGEIQLDLHSC
PKTMVFIIHSFLSAKVTRLGLLA
Download sequence
Identical sequences ENSRNOP00000021715 10116.ENSRNOP00000021715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]