SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021725 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021725
Domain Number 1 Region: 24-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 101-174
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.57e-18
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021725   Gene: ENSRNOG00000016220   Transcript: ENSRNOT00000021725
Sequence length 191
Comment pep:known chromosome:RGSC3.4:3:11951921:11954295:1 gene:ENSRNOG00000016220 transcript:ENSRNOT00000021725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRRRQRCNFLRSSRIRVHPTPATSTMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGP
LGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKK
QKNIKHNGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDD
INSGAVECPAS
Download sequence
Identical sequences 10116.ENSRNOP00000021725 ENSRNOP00000021725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]