SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000021955 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000021955
Domain Number 1 Region: 23-168
Classification Level Classification E-value
Superfamily EF-hand 1.1e-46
Family Calmodulin-like 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000021955   Gene: ENSRNOG00000016409   Transcript: ENSRNOT00000021955
Sequence length 172
Comment pep:known chromosome:RGSC3.4:18:914029:914547:-1 gene:ENSRNOG00000016409 transcript:ENSRNOT00000021955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTFRKSNVASTSYKKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRAL
GFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY
Download sequence
Identical sequences G3V832
ENSRNOP00000021955 NP_445913.1.100692 NP_445913.1.4139 10116.ENSRNOP00000021955 ENSRNOP00000021955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]