SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022000 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022000
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-24
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000285
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 250-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000182
Family LIM domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022000   Gene: ENSRNOG00000016166   Transcript: ENSRNOT00000022000
Sequence length 327
Comment pep:known chromosome:RGSC3.4:1:245350086:245399534:-1 gene:ENSRNOG00000016166 transcript:ENSRNOT00000022000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSS
MTHLEAQNKIKGCVDNMTLTVSRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
NRSAMPFTASPAPGTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPSAQP
HPSGGLIIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKA
PVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHRHPECYVCTDCGINLKQKGHFFVG
DQIYCEKHARERVTPPEGYDVVTVFPK
Download sequence
Identical sequences P52944
10116.ENSRNOP00000022000 ENSRNOP00000022000 ENSRNOP00000022000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]