SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022049 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022049
Domain Number 1 Region: 365-530
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000232
Further Details:      
 
Domain Number 2 Region: 544-667
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 659-741
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000263
Family PDZ domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022049   Gene: ENSRNOG00000016358   Transcript: ENSRNOT00000022049
Sequence length 750
Comment pep:known chromosome:RGSC3.4:1:118970876:119156598:1 gene:ENSRNOG00000016358 transcript:ENSRNOT00000022049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRKRQSTASSMLDHRARPGPIPHDQEPENEDTELPLESYVPTGLELGTLRPDSPTPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYCPEDDSYLEGMDCNGEE
YLAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDSHLPIPEDDPTVLEVHDQ
EEDGHYCPSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEEQEEDIDQIVAEIKMSLSM
TSITSASEASPEHMPELDPGDSTEACSPSDTGRGPSRQEARPKSLNLPPEVKHSGDPQRG
LKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETKKVASFPSFVAVPG
PCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANS
EGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSA
SQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLS
QKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILAN
MMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTT
VLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQA
LSNSVGEIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences O35431
ENSRNOP00000022049 10116.ENSRNOP00000022049 NP_113968.1.100692 NP_113968.1.4139 ENSRNOP00000022049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]