SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022166 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022166
Domain Number 1 Region: 179-378
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.94e-57
Family Prokaryotic proteases 0.00000102
Further Details:      
 
Domain Number 2 Region: 390-485
Classification Level Classification E-value
Superfamily PDZ domain-like 9.73e-22
Family HtrA-like serine proteases 0.0015
Further Details:      
 
Domain Number 3 Region: 42-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number 4 Region: 115-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000018
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022166   Gene: ENSRNOG00000034140   Transcript: ENSRNOT00000022166
Sequence length 488
Comment pep:known chromosome:RGSC3.4:16:71424709:71438884:1 gene:ENSRNOG00000034140 transcript:ENSRNOT00000022166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSKMSSQRLWAVRAQFLLLWLLLWAAPVPWAEARRSRVSLPCPDACDPTRCPPLPSCS
AGSALVPDRCGCCQVCAAVEGQECGGARGRPCVPGLRCGAPFSREPSGRAWLGTCGCAEG
AEGAAVCGSDGRTYPSLCALRKENRAARQRGALPAVPVQKGACGDSGTTRAGRLRTKYNF
IAAVVEKVAPSVVHLQLFRRSPLTNQEIPSSSGSGFIVSEDGLIVTNAHVLTNQQKIQVE
LQNGAQYEATVKDIDHKLDLALIKIEPDTDLPVLLLGRSSDLRAGEFVVALGSPFSLQNT
VTAGIVSTTQRGGKELGLKDSDIDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGI
SFAIPSDRIRQFLADYHERQLKGKAPLQKKYLGLRMLPLTLNLLQEMKRQDPDFPDVSSG
VFVYEVIQGSAAASSGLRDHDVIVSINGQPVTTTTDVIEAVKDNAFLSIIVLRGSQTLFL
TVTPEIIN
Download sequence
Identical sequences D3ZKF5
ENSRNOP00000022166 10116.ENSRNOP00000022166 NP_001100791.1.100692 NP_001100791.1.4139 XP_017455636.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]