SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022375 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022375
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.19e-53
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022375   Gene: ENSRNOG00000016670   Transcript: ENSRNOT00000022375
Sequence length 180
Comment pep:known chromosome:RGSC3.4:17:92950532:92975998:-1 gene:ENSRNOG00000016670 transcript:ENSRNOT00000022375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKELPTLKDNDFINEGQKIYIDDSNKKIFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERA
EQEEVECEENEGEEEGESDGAHPIGTPPDSPGNTLNSSPPLAPGEFDPNIDVYAIKCHEN
APRKEVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
Download sequence
Identical sequences 10116.ENSRNOP00000022375 ENSRNOP00000022375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]