SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022677 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022677
Domain Number 1 Region: 16-124
Classification Level Classification E-value
Superfamily UBC-like 5.05e-27
Family RWD domain 0.00000297
Further Details:      
 
Domain Number 2 Region: 133-203
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000055
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022677   Gene: ENSRNOG00000016886   Transcript: ENSRNOT00000022677
Sequence length 454
Comment pep:known chromosome:RGSC3.4:9:73944152:73950963:-1 gene:ENSRNOG00000016886 transcript:ENSRNOT00000022677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASASTAAGEEDWVLPSEVEVLESIYLDELQVMKGNGRSPWEIFITLHPATAEVQDSQF
VCFTLVLQVPVQYPHEVPQISIRNPRGLSDEQIHKISQALGHVAKEGLGTAMLYELIEKG
KEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLARYIQHMEQELNTQEQEQQ
HVVTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEELKRLYQRQ
QEKGGIIDLEAERNRYFISLQQPPAALEPESVVDVSRGPQPPNTLSAEQSTSLAAQSTLP
TPLPMATQYVYEKTSGAGPNQQRLGETQKSMLDPPRPGRGSWRQYDRRHPKGGECCAPKG
TSEIQELPPPEKPLKETVDLKAEPRNKGLTGHPQEKGPGSWQGPSARRTRDCARWERSKN
RTPGSSYPHLPRGQGAYRSGTRREPLGLESEEGS
Download sequence
Identical sequences D3ZQ26
NP_001012004.2.100692 NP_001012004.2.4139 10116.ENSRNOP00000022677 ENSRNOP00000022677 ENSRNOP00000022677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]