SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022721 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022721
Domain Number 1 Region: 48-441
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.59e-85
Family AAT-like 0.0000008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022721   Gene: ENSRNOG00000016348   Transcript: ENSRNOT00000022721
Sequence length 454
Comment pep:known chromosome:RGSC3.4:19:39854122:39865374:1 gene:ENSRNOG00000016348 transcript:ENSRNOT00000022721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYVIQTDVDDSLSSVLDVHVNIGGRNSVQGRKKGRKARWDVRPSDMSNKTFNPIRAIV
DNMKVQPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSRE
EVASYYHCHEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMG
IEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ
CVPILADEIYGDMVFSDCKYEPLANLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDI
FGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYHDTLSFLKSNADLCYGALAAI
PGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQAVHCLPATCFEYPNFFRVVI
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK
Download sequence
Identical sequences P04694
NP_036800.1.100692 NP_036800.1.4139 ENSRNOP00000022721 ENSRNOP00000022721 10116.ENSRNOP00000022721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]