SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023285 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023285
Domain Number 1 Region: 279-339
Classification Level Classification E-value
Superfamily GYF domain 1.02e-18
Family GYF domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023285   Gene: ENSRNOG00000017201   Transcript: ENSRNOT00000023285
Sequence length 340
Comment pep:known chromosome:RGSC3.4:1:186451417:186454914:-1 gene:ENSRNOG00000017201 transcript:ENSRNOT00000023285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRKVTFQGVGDEDDEDEISVPKKKLVDPVAGAGGPGSRFKGKHSLDSDEEDDDEGSSK
YDILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNQDSQIRDSWLDN
IDWVRIKERPPDKQQVSDSEEEGSLGQTPMSVQALLEGLLELLLPRETVAGALRRLGARG
GGKGNSKGTGRPNSPQRLDRLSGLADQMVARGNLGVYQETRERLAMRLKGLGCRTQGSHD
PTPPPSLDMFAEEVTEGELETPTPTHREEADSAGDGLMDVMWEYKWENTGDAELYGPFTS
AQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Download sequence
Identical sequences B4F786
NP_001099767.1.100692 NP_001099767.1.4139 XP_006230313.1.100692 XP_006230314.1.100692 XP_008758101.1.100692 ENSRNOP00000023285 10116.ENSRNOP00000023285 ENSRNOP00000023285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]