SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023710 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023710
Domain Number 1 Region: 1064-1199
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000504
Family Plakophilin 1 helical region 0.088
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023710
Domain Number - Region: 137-210
Classification Level Classification E-value
Superfamily HR1 repeat 0.00615
Family HR1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023710   Gene: ENSRNOG00000017604   Transcript: ENSRNOT00000023710
Sequence length 1217
Comment pep:known chromosome:RGSC3.4:19:35438876:35446551:1 gene:ENSRNOG00000017604 transcript:ENSRNOT00000023710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSLSVRPQRRLLSARVSRSQSFAGVLGSQERGPRNFTVFSPPGPQRKPLVLSRVSRMFS
VAHPAPKVPQPERLDLVYAALKRGLTAYLEVHQQEQEKLQRQIKESKRNSRLGFLYDLDK
QVKSIERFLRRLEFHASKIDELYEAYCVQRRLRDGAYNMVRAYSTGSPGSREARDSLAEA
TRGHREYTESMCLLENELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQRWKLRGR
IESSGKQVWDSEETVFLPLLTEFLSIKVTELKGLANHVVVGSVSCETKDLFAALPQVVAV
DINDLGTIKLSLEVIWSPFDKDDQPSAASTVNKASTVTKRFSTYSQSPPDTPSLREQAFY
NMLRRQEELENGTAWSLSSESSDDSSSPQLSGTARYSSTPKPLVQQPEPLPVQVTFRRPE
SLSSGSMDEEPPLTPALVNGHAPYSRTLSHISEASVDAALTEAMEAVDLKCPAPGPSPLV
YPESTHVEHVSSVPPVADNGRSATSPALSTAGPAPTFIDPASSTQLDLVHKATDSGSSEL
PSITHTMASSTYSAVSPINSVPGLTSTTVGSTHKPMPSPLTSTGSIPSVTDSIQTTTSPT
HTTPSPTHTTVSPTHSTPSPTHTTVSPSNAALSPSNATPSLSHSTTSPTQKATMSTHTTS
AVGPVQTTTSPISTTVSPSPSVDTAIISSSSAVPSVPGPEARPCSHPTSTPYTKADPTAA
CTSSPSLASSGPKPLTSPAPDSLEQILKSPSSSPSSIVPEPQRSELSLALVAQAPVPEAT
GGAGDRRLEEALRTLMAALDDYRGQFPELQGLEQEVTRLESLLMQRQGLTRSRASSLSIT
VEHALESFSFLNDDEDEDNDSPGDRPTSSPEVVAEERLDSSNAQCLSTGCSALDATLVQH
LYHCSCLLLKLGTFGPLRCQEAWALERLLREARVLQEVCEHSKLWGNAVTSAQEVVQFSA
SRPGFLTFWDQCTEGLNPFLCPVEQVLLTFCSQYGARLSLRQPGLAEAVCVKFLEDALGQ
KLPRRPHSGPGEQLTIFQFWSYVEVLDSPSMEAYVTETAEEVLLVQNLNSDDQAVVLKAL
RLAPEGRLRKDGLRALSSLLVHGNSKVMAAVSTQLRSLSLGPVFRERALLCFLDQLEDED
VQTRVAGCLALGCIKAPEGIEPLVYLCQTDTEAVREAARQSLQQCGEEGQSAHRQLEESL
DALPCLFGPSSMASTAF
Download sequence
Identical sequences Q4FZU8
ENSRNOP00000023710 NP_001094130.1.100692 NP_001094130.1.4139 10116.ENSRNOP00000023710 ENSRNOP00000023710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]