SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024035 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024035
Domain Number 1 Region: 72-234,291-532
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.91e-113
Family GABA-aminotransferase-like 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024035   Gene: ENSRNOG00000017821   Transcript: ENSRNOT00000024035
Sequence length 540
Comment pep:known chromosome:RGSC3.4:2:59713396:59755138:1 gene:ENSRNOG00000017821 transcript:ENSRNOT00000024035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAWRTLQKAFYLETSLRILQMRPSLSSGASRIYVPKLTLHTKHNMPPCDFSPEKYQSL
AYNHVLEIHKQHLSPVNTAYFQKPLLLHQGHMEWLFDSEGNRYLDFFSGIVTVGVGHCHP
KVTAVAKKQMDRLWHTSSVFFHSPMHEYAERLSALLPEPLKVIFLVNSGSEANDLAMVMA
RAYSNHTDIISFRGAYHGCSPYTLGLTNVGIYKMKVPSTIACQSTMCPDVFRGPWGGSHC
RDSPVQTVRKCSCAPGPTGQRGMARCHSLIKCCDLCMCVCAADGCQAKERYIEQFKDTLN
TSVATSIAGFFAEPIQGVNGVVQYPKEFLKEAFALVRERGGVCIADEVQTGFGRLGSHFW
GFQTHDTMPDIVTMAKGIGNGFPMAAVVTTPEIASSLAKHLHHFSTFGGSPLACAIGSAV
LEVIEEENLQRNSQEVGTYMLLKFAKLRDEFDIVGDVRGKGLMVGIEMVQDKISRQPLPK
TEVNQIHEDCKDMGLLVGRGGNFSQTFRIAPPMRVTKLEVDFAFEVFRSALTQHMERRAK
Download sequence
Identical sequences ENSRNOP00000024035 10116.ENSRNOP00000056699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]