SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024102 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024102
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily Aquaporin-like 1.57e-66
Family Aquaporin-like 0.00000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024102   Gene: ENSRNOG00000017685   Transcript: ENSRNOT00000024102
Sequence length 265
Comment pep:known chromosome:RGSC3.4:7:138337719:138341256:1 gene:ENSRNOG00000017685 transcript:ENSRNOT00000024102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEVCSLAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQAL
GPVSGGHINPAITLALLIGNQISLLRAVFYVAAQLVGAIAGAGILYWLAPLNARGNLAVN
ALNNNTTPGKAMVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAMLAAILYFYLLFPSSLSLHDRVAVVK
GTYEPEEDWEDHREERKKTIELTAH
Download sequence
Identical sequences P47864
ENSRNOP00000024102 NP_036911.1.100692 NP_036911.1.4139 ENSRNOP00000024102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]